SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1LJG4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I1LJG4
Domain Number - Region: 229-290
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0942
Family Capz alpha-1 subunit 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I1LJG4
Sequence length 412
Comment (tr|I1LJG4|I1LJG4_SOYBN) Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit {ECO:0000256|RuleBase:RU361142} KW=Complete proteome; Reference proteome OX=3847 OS=Glycine max (Soybean) (Glycine hispida). GN=GLYMA_11G120300 OC=Phaseoleae; Glycine; Soja.
Sequence
MTSPSNPLILSLNSLKSRGFDLQFHLADDPKIALQRYGQYLYDALILFSPTIERFGGSID
AAAILDFVDSGHDLIVAADSNASDLIREIATECGVDFDEDPAAVVVDHSGYAVSATEGDH
TLIASDDFIKSDVILGSKKIEAPVLFQGIGHSLNPTNSLVLKVLSASPSAFSANPKSKLT
SPPSLTGTSISLVSVIQARNNARILISGSLSLFSNRFFTSGVQKAGSPTKHEKSGNEQFL
NELSKWIFHERGHLKAVHVQHHKVGEANEPAIYRINDNLEYSVEVYEWSGTTWEPYVADD
VQVQFYMMSPYVLKTLSTDGKGHYFTSFKVPDVYGVFQFKVEYEKLGYTSLSLSKQIPVR
PFRHNEYERFIPAAYPYYGAAFSMMAGFFIFTAVHLYSKCITFLPASVGLTI
Download sequence
Identical sequences I1LJG4
Glyma11g12800.1|PACid:16283676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]