SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1LUF8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I1LUF8
Domain Number - Region: 107-188
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0785
Family Capz beta-1 subunit 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I1LUF8
Sequence length 323
Comment (tr|I1LUF8|I1LUF8_SOYBN) Clathrin light chain {ECO:0000256|RuleBase:RU363137} KW=Complete proteome; Reference proteome OX=3847 OS=Glycine max (Soybean) (Glycine hispida). GN=GLYMA_12G203500 OC=Phaseoleae; Glycine; Soja.
Sequence
MASFEEQSHQSPTRGPFDDDNSYTDTDMGMGYESHQHYDYDDQHPQLNVDPNNNNFTDNS
HSPSVYGFGVSTPNPDHVSPFEPATADDTTFTSDGPMLPDPSQMQEEGHARREWRRLNAI
HLEEKEKREKEMRNQIIKEAEEYKEAFYEKRKVNCEKNKENNREREKIYLANQEKFHKEA
HNHYWKAIAEIIPREVPNIEKRRGKKEAENKPSVHVIQGPKPGKPTDLARMRQMILKLKQ
NPPSHMMPPPPKEEKDSKEGKDNKNAKEGKDDKGGKSSTPTATTGVVGNKPTSPAKDVAP
EGEAQDPAIVEGEQVASSEPKAA
Download sequence
Identical sequences I1LUF8
XP_003539531.1.40590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]