SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I1PQZ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I1PQZ9
Domain Number - Region: 28-88
Classification Level Classification E-value
Superfamily Vanabin-like 0.0667
Family Vanabin-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I1PQZ9
Sequence length 138
Comment (tr|I1PQZ9|I1PQZ9_ORYGL) Uncharacterized protein {ECO:0000313|EnsemblPlants:ORGLA04G0261800.1} KW=Complete proteome; Reference proteome OX=4538 OS=Oryza glaberrima (African rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MFSGEWTPPCGSCCTKKYASLVQIPWRVFCKKGCDADGDTWDECISKCTEICYKDPVLED
HQWSAYIDRSPGQDSYSLECFNACVSGCGYRFDIPAEKVEQIKPNRPSKPPPPPPPAVER
ATNSEPAVKGEDVPCTSA
Download sequence
Identical sequences A0A0D9ZSJ2 A0A0E0DK88 A0A0E0H7K3 B8ARH3 I1PQZ9 Q7XKD6
LOC_Os04g58380.1|13104.m06129|protein 39946.BGIOSIBCE017097 39947.LOC_Os04g58380.1 ORGLA04G0261800.1 OsIBCD016033 XP_015634311.1.37577 LOC_Os04g58380.1|PACid:21895965 ONIVA04G28360.1 OMERI04G24970.1 OGLUM04G29790.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]