SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1XHL9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I1XHL9
Domain Number - Region: 159-226
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0183
Family Capz alpha-1 subunit 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I1XHL9
Sequence length 251
Comment (tr|I1XHL9|I1XHL9_METNJ) Uncharacterized protein {ECO:0000313|EMBL:AFI83888.1} KW=Complete proteome; Reference proteome OX=754476 OS=25689 / JAM1). GN=Q7A_1046 OC=Piscirickettsiaceae; Methylophaga.
Sequence
MKFSVKVTKVLLLFTLLVASSSHADWKKFLEDFSKSGSTALGTSEGSVLSSDTIANGLKE
ALEVGTRKAVENVSKEGGYFNNPKIRIPLPPRVQQAAGLMRQLGLNKMADDFEESINRAA
EKAAPQATSIMIDAIKNMTIDDAHNILNGHNDAATRFFEERTRNKLADLFKPIIDSSLNE
VGATRYYNQLDDKLSSVPLVGQELNMDLQSYVTDQTLDGLFVMLAQEEQQIRSNPAARTS
KILQQVFGNKE
Download sequence
Identical sequences I1XHL9
gi|387126928|ref|YP_006295533.1| WP_014706263.1.63735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]