SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I2B1N0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I2B1N0
Domain Number 1 Region: 1-103
Classification Level Classification E-value
Superfamily Nucleocapsid protein dimerization domain 1.81e-37
Family Coronavirus nucleocapsid protein 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I2B1N0
Sequence length 139
Comment (tr|I2B1N0|I2B1N0_9ALPC) Nucleocapsid protein {ECO:0000313|EMBL:AFJ44336.1} OX=693997 OS=Alphacoronavirus 1. GN=N OC=Nidovirales; Coronaviridae; Coronavirinae; Alphacoronavirus.
Sequence
NKHTWKRTAGKGDVTKFYGSRSSSANFGDSDLVANGNSAKHYPQLAECVPSVSSILFGSH
WTAKEDGDQIEVTFTHKYHLPKDDPKTGQFLEQINAYTRPSEVAKEQGQRKSRSKSVEKK
QDDLPEPLVENYTDVFDDT
Download sequence
Identical sequences I2B1L9 I2B1M0 I2B1N0 I2B1N4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]