SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I2DGU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I2DGU0
Domain Number - Region: 43-98
Classification Level Classification E-value
Superfamily Staphylokinase/streptokinase 0.0785
Family Staphylokinase/streptokinase 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I2DGU0
Sequence length 121
Comment (tr|I2DGU0|I2DGU0_HELPX) Uncharacterized protein {ECO:0000313|EMBL:AFJ81956.1} KW=Complete proteome OX=1127122 OS=Helicobacter pylori XZ274. GN=MWE_1229 OC=Helicobacteraceae; Helicobacter.
Sequence
MRFKSVVAFISLAVALGVLAYLFLSVKKEMPAISHADKNLSQTDAKSHDINLEENSPNEV
SHNENETSHNEKAPHNEEDRNNALSQNLDTQEVINYPVIEHHFEIPFEEKKGSIQSLSLR
I
Download sequence
Identical sequences I2DGU0
gi|387908313|ref|YP_006338647.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]