SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I2G9C8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I2G9C8
Domain Number 1 Region: 8-282
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 5.49e-100
Family Capz alpha-1 subunit 0.000000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I2G9C8
Sequence length 287
Comment (tr|I2G9C8|I2G9C8_NEMVE) F-actin capping protein subunit alpha {ECO:0000313|EMBL:CCH23112.1} OX=45351 OS=Nematostella vectensis (Starlet sea anemone). GN=capZ OC=Edwardsiidae; Nematostella.
Sequence
MADYDEPISDDEKIRIASDFIKHAPPGALNEVFNDVRILLDNDTLLKERAASSFSDYNKE
QFTPAKLSGDEQVLITRHGELSDGSFIDPKSKQKFSYDHLRKEASNLTAQETGSTAEPWR
AAVDQAFRAYVKDHYPHGVCTVYGSSTDGLITIVACLEDHKFEPQNFWNGRWRSEWSASF
KKSGETVDMNGDLKLQVHYYEDGNVQLVSSKEIQHELKVASEAATAKNFVQNIEESENEY
QKAISENYTQMSDTTFKALRRQLPITRTKIDWNKILNYKIGQELKSS
Download sequence
Identical sequences I2G9C8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]