SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I2G9E3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I2G9E3
Domain Number 1 Region: 1-196
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.75e-65
Family Capz beta-1 subunit 0.0000000499
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I2G9E3
Sequence length 200
Comment (tr|I2G9E3|I2G9E3_9CNID) F-actin capping protein subunit beta {ECO:0000313|EMBL:CCH23127.1} OX=252671 OS=Clytia hemisphaerica. GN=capZ OC=Campanulariidae; Clytia.
Sequence
SPWSNTYDPPLDDGALPSDRLRKLEIDANAAFDQYREMYFEGGVSSVYLWDLDHGFAGVI
LIKKAGDGSKKIRGCWDSIHVVEVQEKSGGSKAHYKLTSTAMLWLQTNKASSGTMNLGGS
LTRQTEMDNAVSDSNPHIINIGRMIEDMENKIRNTLNEIYFGKTRDIVNSVRSINNLEDK
KKQNNLQAELFKNLKARQEK
Download sequence
Identical sequences I2G9E3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]