SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I2JT15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I2JT15
Domain Number 1 Region: 6-264
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.09e-59
Family Capz alpha-1 subunit 0.0000959
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I2JT15
Sequence length 271
Comment (tr|I2JT15|I2JT15_DEKBR) Cap1p {ECO:0000313|EMBL:EIF46117.1} KW=Complete proteome; Reference proteome OX=1124627 OS=Brettanomyces bruxellensis AWRI1499. GN=AWRI1499_3999 OC=Saccharomycetes; Saccharomycetales; Pichiaceae; Brettanomyces.
Sequence
MTDTTSLQGIIRSMIEDAPPGSAAPLQKDIXTILNNDDSRKVIAEDLKQYHLNKNYKLVK
LTDKDFGIISKYNKSGLKYYDPLLKLKFDYDFDQLKVIDIEENGVEENAEINALNEKICD
YALQHFPTFYKGMAIQDGENANIVYXIIVDENLNDANFYNGRWQSFYKLDKGNGELTGEI
TVKVHYYEDGNVALNTGKHIHETNINVDNIVETISKLEDEFEKALLKNFVALNEHQFKNL
RRQLPINRSKVQWGKSIRTYKLGQDAAEGRK
Download sequence
Identical sequences I2JT15

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]