SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3ENQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3ENQ0
Domain Number 1 Region: 195-302
Classification Level Classification E-value
Superfamily Cyclin-like 1.67e-21
Family Cyclin 0.0021
Further Details:      
 
Weak hits

Sequence:  I3ENQ0
Domain Number - Region: 15-56
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0418
Family Capz alpha-1 subunit 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3ENQ0
Sequence length 395
Comment (tr|I3ENQ0|I3ENQ0_NEMP1) Uncharacterized protein {ECO:0000313|EMBL:EIJ93508.1} KW=Complete proteome OX=881290 OS=fungus). GN=NEPG_01850 OC=Eukaryota; Fungi; Microsporidia; Nematocida.
Sequence
MLKRVLEDITNICHTNIRVTIKKEEKPIRREILAAYLEYAETYYKHLNRVLSHTKEIGRK
YEEVEGMTLYAEVEDRIMRENKSSIKEIRGIFTSTDKPAPSAVNSSLINRLYCNRKSERF
PEDALFSIPVQDIFKAHNITGEKGSSIKRRKYEEYPREATKISAVKRPCRASESSSDEID
ISTEEYKDRGECSQSMQVGIKSRKSQITMKMRQTLLEWMYDVKVDYKLASSIYQVAVRIT
DKYFLITALPKEKYQLVGAVSLFIANKLMACKSRSLMAYVDVCDGAYSKEEFLVCERDIL
MRMGGCLNFLLPQHIITEDKYLVGNALCEYASESVLLDASYACLAPKELSHFIESNISAC
LNGETPSPRFASLLKKSAVLLDQQIKQVRELVKKL
Download sequence
Identical sequences I3EI91 I3ENQ0
XP_013059678.1.1480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]