SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3KBF7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KBF7
Domain Number 1 Region: 7-280
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.22e-114
Family Capz alpha-1 subunit 0.000000000865
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3KBF7
Sequence length 285
Comment (tr|I3KBF7|I3KBF7_ORENI) Uncharacterized protein {ECO:0000313|Ensembl:ENSONIP00000018452} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC100694535 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MADFEELSDEEKVRIAANFVMHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQ
FTRAKIDGYEEPVLITEHGDLGNGRFFDPHNKISFKFDHLRKEASDPQPHQGEAALSSWR
DACDSAIRAYVKEHYPSGVSTVYGKTIDGQKTIIACIEGHQYEPKNFWNGRCRSEWKFSV
SQPTAQVAGVLKIQVHYYEDGNVQLVSHKDVQKSLTVSNESQTAKELVKIIEDAENEYQV
AISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences I3KBF7
ENSONIP00000018452 XP_003453692.1.78416 ENSONIP00000018452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]