SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3KRT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KRT8
Domain Number 1 Region: 30-282
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.53e-95
Family Capz beta-1 subunit 0.000000000514
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3KRT8
Sequence length 299
Comment (tr|I3KRT8|I3KRT8_ORENI) Capping protein (actin filament) muscle Z-line, beta {ECO:0000313|Ensembl:ENSONIP00000023833} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=capzb OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
DCRRITFPFSCIKEKCLDSFFRGGGAVNNDQQLDCALDLMRRLPPQQIEKNLSDLIDLVP
SLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYEPPIEDGAMPSARL
RKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHV
VEVQEKSSGRTAHYKLTSTVMLWLQTTKTGSGTMNLGGSLTRQMEKDETVGESSPHIANI
GRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTLADKSKQEALKVDLMEALKRKHNS
Download sequence
Identical sequences I3KRT8
ENSONIP00000023833 ENSONIP00000023833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]