SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3QJP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I3QJP6
Domain Number - Region: 23-93
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.00745
Family Occludin/ELL domain 0.012
Further Details:      
 
Domain Number - Region: 3-38
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0215
Family Nanomeric phage protein-like 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3QJP6
Sequence length 237
Comment (tr|I3QJP6|I3QJP6_ECOLX) Prophage 1752-type terminase large subunit {ECO:0000313|EMBL:AFK09680.1} OX=562 OS=Escherichia coli. GN= OC=Enterobacteriaceae; Escherichia.
Sequence
YPPAEISRLMGINPNTIYAWKKRDQWDETPPVQRVTQSIDARLIQLTEKQNKTGGDFKEI
DLLTRQLKKLHDGQPDATATGKKGRAKKLKNHFTPEQIAALREKIISRLEWHQRGWFDSL
TLCSEAGIRNRMILKSRQIGATWYFAQEALLMALRDDVAQPYQRNQIFLSASRRQAFQFK
SIIQKAAAEVDVELKGGDKIILSNGAELHFLGTSAATAQSYTGNFYFDEFFWVSRFA
Download sequence
Identical sequences I3QJP6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]