SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3RF25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3RF25
Domain Number 1 Region: 169-261
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.0000948
Family MOA C-terminal domain-like 0.078
Further Details:      
 
Weak hits

Sequence:  I3RF25
Domain Number - Region: 73-209
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0942
Family Capz alpha-1 subunit 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3RF25
Sequence length 340
Comment (tr|I3RF25|I3RF25_9EURY) Uncharacterized protein {ECO:0000313|EMBL:AFK22835.1} KW=Complete proteome OX=1183377 OS=Pyrococcus sp. ST04. GN=Py04_1261 OC=Pyrococcus.
Sequence
MENGKHRKILEECSRELEVLEPKIAKKIRELQNLTPKDAFLEYLRLLDEVSRMKIGKRKK
NSILLTLWKYGEKLETIVNPEQKHFLKFQYKFRRFRFIDFNILGLFFIVFLLMPALSSFL
WNFQNDHVIINKHEVVTFNENLCRYRTAWLYDFRASMVCVLIYRYGNVRIKLNTTNPWEA
AMEVEKLISRIPYDYGRLKSVVTYIQTPEETIGRKIGVCSDFALLIAQIFLYNNITPVYI
VHTVFKGDESGGHAAAAIMYNGTLWIVDWGSNPTKFETFVEKIGRIWEVREIRIYKITKS
AIILDRIYKAKLENDQWRFAYFLTIAIGIFLMKRKEWWLI
Download sequence
Identical sequences I3RF25
WP_014734359.1.16002 gi|389852676|ref|YP_006354910.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]