SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3SB22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I3SB22
Domain Number - Region: 45-79
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00497
Family Capz beta-1 subunit 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3SB22
Sequence length 84
Comment (tr|I3SB22|I3SB22_LOTJA) Uncharacterized protein {ECO:0000313|EMBL:AFK37464.1} OX=34305 OS=Lotus japonicus (Lotus corniculatus var. japonicus). GN= OC=Loteae; Lotus.
Sequence
MQICLHGKLHLMMRNWTIALLASHDDQASSFVENLKALTCLLFLCYVTLVDLDYVFMLYI
CVEDGKVDLRDMFKGFWCSTEGVV
Download sequence
Identical sequences I3SB22

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]