SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3SCY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3SCY0
Domain Number 1 Region: 2-246
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.22e-72
Family Capz beta-1 subunit 0.00000031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3SCY0
Sequence length 256
Comment (tr|I3SCY0|I3SCY0_MEDTR) Uncharacterized protein {ECO:0000313|EMBL:AFK38122.1} OX=3880 OS=Medicago truncatula (Barrel medic) (Medicago tribuloides). GN= OC=Trifolieae; Medicago.
Sequence
MEAAMGLMRRIPPKHTETALSALLSLMPNHSSDLLSQVDQPLQVLCDVDCGKEFILCEYN
RDADSYRPPWSNKYHPPLEDGSLPSSELRKLEIEANDIFAIYRDQYYEGGISSVYMWEDE
NEGFVACFLIKKDGSKTGQGRRGYLEEGAWDAIHVIEVGPEEEEDTNYRLTSTVMLTLTT
NNESSGTFSLSGSIRRQMSMRLSVADGHLCNMGRMIEEMESKLRNSLDQVYFGKTREMVC
TLRPPSEVAQMRMPES
Download sequence
Identical sequences I3SCY0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]