SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3SU17 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3SU17
Domain Number 1 Region: 4-267
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 6.67e-89
Family Capz alpha-1 subunit 0.000000304
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3SU17
Sequence length 273
Comment (tr|I3SU17|I3SU17_LOTJA) Uncharacterized protein {ECO:0000313|EMBL:AFK43759.1} OX=34305 OS=Lotus japonicus (Lotus corniculatus var. japonicus). GN= OC=Loteae; Lotus.
Sequence
MDTISDAEKVKIAGGFLLNAPPGEFNDVFNDIRVLIGNDQLPQRGVTPHFEQYNTEQFTP
VDVPGQSHKVIISKFSQIDTSHYFDPRSNQSFTFDHLRQVASDPQPHSGASHPQRKAVDD
AFQEYINEHFSTGIVSVYPHDGHLVVCVVANKYNPRNYWNGRWRSQWTVEISGDQAKAKG
VLRSQVHYYEDGNVQLNSEKSVEVTASGGDIANKIVQAAKKAEIEYQTAINESYGQLSST
TFKALRRALPITGTKLDWNKILAYKIGGELSQK
Download sequence
Identical sequences I3SU17

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]