SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3T7I6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3T7I6
Domain Number 1 Region: 2-248
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.58e-72
Family Capz beta-1 subunit 0.000000317
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3T7I6
Sequence length 256
Comment (tr|I3T7I6|I3T7I6_LOTJA) Uncharacterized protein {ECO:0000313|EMBL:AFK48478.1} OX=34305 OS=Lotus japonicus (Lotus corniculatus var. japonicus). GN= OC=Loteae; Lotus.
Sequence
MEAAMGLMRRIPPKHTDTALSALLSLMPNHSSDLLSQVDQPLQVLCDVDSGKEFILCEYN
RDADSYRSPWSNKYHPPLEDGSLPSAELRKLEIEASDIFAIYRDQYYEGGISSVYMWEDD
NEGFVACFLIKKDGSKTGQGRRGYLEEGAWDAIHVIEVGPEEEENTNYRLTSTVMLTLTT
SNESSGTFSLSGSIRRQMNMKLSVADGHLCNMGRMIEEMESKLRNSLDQVYFGKTREMVC
TLRPPAEVAQMRIPES
Download sequence
Identical sequences I3T7I6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]