SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I4AME5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I4AME5
Domain Number - Region: 29-126
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 0.012
Family Clostridium neurotoxins, "coiled-coil" domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I4AME5
Sequence length 199
Comment (tr|I4AME5|I4AME5_BERLS) Uncharacterized protein {ECO:0000313|EMBL:AFM05130.1} KW=Complete proteome; Reference proteome OX=880071 OS=NCIMB 1366 / Sio-4) (Flexibacter litoralis). GN=Fleli_2777 OC=Bernardetia.
Sequence
MSVSKSMLNIFQNSFQSKLQSLQSFQIELQDKKEITIEKFETQRQQLQILIVEIADFLDD
LTLPMIEKNPFFIEDVLIFLDEFVKEIETQFRLFTTLSVSSLREQVAKTSQNFETKALKE
VFEEKQKQTLVQTELLLQTLNTQLIDIRHRIEKQKDLILNSSSSLTSLSLPSFSELETLS
KKTESNFELIKQDVKRLFM
Download sequence
Identical sequences I4AME5
gi|392398322|ref|YP_006434923.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]