SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I4AP47 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I4AP47
Domain Number 1 Region: 4-153
Classification Level Classification E-value
Superfamily AF1862-like 7.32e-30
Family Cas Cmr5-like 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I4AP47
Sequence length 158
Comment (tr|I4AP47|I4AP47_BERLS) CRISPR-associated protein, Cmr5 family {ECO:0000313|EMBL:AFM05732.1} KW=Complete proteome; Reference proteome OX=880071 OS=NCIMB 1366 / Sio-4) (Flexibacter litoralis). GN=Fleli_3411 OC=Bernardetia.
Sequence
MSNRKKLEQGRAEFAYQCAEKGNEVSLKKTDVFENEVYYKDSKYKSYVKSIPMMIKANGL
GATFAFILSKGAKDKKSDKAGTEKNPKNAYDLIYLQTYNYLSSFDKLDLFDNTKKEDLVN
VIISKDSSQYRYLTVETLAFFNWLRRFAEGLVKGGEDE
Download sequence
Identical sequences I4AP47
gi|392398924|ref|YP_006435525.1| WP_014799158.1.630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]