SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I4L9A8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I4L9A8
Domain Number - Region: 166-224
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0706
Family Capz beta-1 subunit 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I4L9A8
Sequence length 287
Comment (tr|I4L9A8|I4L9A8_9PSED) Probable queuosine precursor transporter {ECO:0000256|HAMAP-Rule:MF_02088} KW=Complete proteome OX=96901 OS=Pseudomonas synxantha BG33R. GN=PseBG33_4598 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MTTFEGAVENSKYKLLGFENDKRLAVIMVIATGKVVKIKLSEVLNSEMMDNFNKLEIKNL
YKKFYSQAGALTAYDINDRNENSWMIYIILNLLLFTFYIFTSIAATKPIYLESMGIIVTP
GTFLYPLTFLIVDLLNENFGLRLARRAIMFAFASNAMIIILLYGSTFLPGLPGWKLDGPY
NDVILQVSSVLVASSVSFLVSENINSYLLCKIKELTNSRYLYLRIFFSTFFAVIIDSFLF
CFIAFYGAMQTSDILSMIYVQIAIKVGFAFFNILPAYGARSLFKRYQ
Download sequence
Identical sequences I4L9A8
WP_005791245.1.63407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]