SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I4Y9X6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I4Y9X6
Domain Number 1 Region: 2-162
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.71e-39
Family Capz beta-1 subunit 0.0000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I4Y9X6
Sequence length 164
Comment (tr|I4Y9X6|I4Y9X6_WALMC) Subunits of heterodimeric actin filament capping protein Capz {ECO:0000313|EMBL:EIM20768.1} KW=Complete proteome; Reference proteome OX=671144 OS=(CBS 633.66)). GN=WALSEDRAFT_60836 OC=Wallemiomycetes; Wallemiales; Wallemiales incertae sedis; Wallemia.
Sequence
MNDALETYRDMYFEGGLSGVYLWDLDGSANFAGVVLIKKTVDDGSWDSVHVFEVSTHGRE
ANYKLTTTVILSLKNDEKESKTNLSGSLTRQCETNANVPAPSAHITNIGRLIEEHERGIR
NSLAEVYLGKTKDILNEIRIINGQGEEFRKRSLQQELLGKLKSK
Download sequence
Identical sequences I4Y9X6
jgi|Walse1|60836|estExt_fgenesh1_kg.C_150065 XP_006959293.1.58810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]