SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I4YIV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I4YIV7
Domain Number 1 Region: 4-128,260-398
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.18e-60
Family Capz alpha-1 subunit 0.0000798
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I4YIV7
Sequence length 406
Comment (tr|I4YIV7|I4YIV7_WALMC) Subunits of heterodimeric actin filament capping protein Capz {ECO:0000313|EMBL:EIM23899.1} KW=Complete proteome; Reference proteome OX=671144 OS=(CBS 633.66)). GN=WALSEDRAFT_66787 OC=Wallemiomycetes; Wallemiales; Wallemiales incertae sedis; Wallemia.
Sequence
MSSTEIVKKILKQSPPNELNDVLEDLKVLTDIDQDTLDTCLKEYNEEQFNSIDLDGVRTL
ITPHSHFEGEKYYDPKSSKLFTLNQLELKTNSAEEVDQLSYKNEARSLLEKSLDSYVEEY
FSNGTAAVYTSLKNIQGSLQSQEEQDTVEEAKDSDSNKETARNTENTEMTEAEHGTEEEQ
NEDNKDKEDKEEQKKDNEDVETPQEQEQEQKEDNEDAEKPEEQPEEPVEDKPIEESKEPE
GSVPAETTQVHQETTEDTTENTPSEEITSMNICYAGNKFNQSNYWSGRWRANWVYDLTTN
ELIGNINITIHYFENGNVQLQASHNPKIKSPLEGPPTTEEEAKKLVKAISESDRAYQAYI
NVLYEDKLSEKLFRSLRRALPITREKINWDKVVNYKLGSELGKLNN
Download sequence
Identical sequences I4YIV7
jgi|Walse1|66787|estExt_Genemark1.C_10068 XP_006955741.1.58810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]