SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I6Q9B3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I6Q9B3
Domain Number - Region: 34-74
Classification Level Classification E-value
Superfamily ERP29 C domain-like 0.0262
Family ERP29 C domain-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I6Q9B3
Sequence length 76
Comment (tr|I6Q9B3|I6Q9B3_9CAUD) Uncharacterized protein {ECO:0000313|EMBL:AFK13498.1} OX=1176767 OS=Yersinia phage YpsP-G. GN= OC=Autographivirinae; T7virus.
Sequence
MGKDMVNQPAHYTSGGIECLDAIRASMTEEAFKGFLKGNVLKYMWRYEKKFNPTEDLKKA
QWYLKRLEEANEKDKP
Download sequence
Identical sequences I6Q994 I6Q9B3 I6Q9W4 L0HTA9 M9PKB4 Q858M9
NP_848270.1.60876 Q858M9_9CAUD gi|30387461|ref|NP_848270.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]