SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I7DJE7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I7DJE7
Domain Number 1 Region: 1-150
Classification Level Classification E-value
Superfamily Coronavirus RNA-binding domain 6.54e-48
Family Coronavirus RNA-binding domain 0.00053
Further Details:      
 
Domain Number 2 Region: 227-334
Classification Level Classification E-value
Superfamily Nucleocapsid protein dimerization domain 2.18e-39
Family Coronavirus nucleocapsid protein 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I7DJE7
Sequence length 377
Comment (tr|I7DJE7|I7DJE7_CVHNL) Nucleoprotein {ECO:0000256|PIRNR:PIRNR003888, ECO:0000256|SAAS:SAAS00869216} KW=Complete proteome OX=277944 OS=Human coronavirus NL63 (HCoV-NL63). GN=N OC=Nidovirales; Coronaviridae; Coronavirinae; Alphacoronavirus. OH=9606
Sequence
MASVNWADDRAARKKFPPPSFYMPLLVSSDKAPYRVIPRNLVPIGKGNKDEQIGYWNVQE
RWRMRRGQRVDLPPKVHFYYLGTGPHKDLKFRQRLDGVVWVAKEGAKTVNTSLGNRKRNQ
KPLEPKFSIALPPELSVVEFEDRSNNSSRASSRSSTRNNSRDSSRSTSRQQSRTRSDSNQ
SSSDLVAAVTLALKNLGFDNQSKSPSSSGTSTPKKPNKPLSQPRADKPSQLKKPRWKRVP
TREENVIQCFGPRDFNHNMGDSDLVQNGVDAKGFPQLAELIPNQAALFFDSEVSTDEVGD
NVQITYTYKMLVAKDNKNLPKFIEQISAFTKPSSIKEMQSQSSHVVQNTVLNASIPESKP
LADDDSAIIEIVNEVLH
Download sequence
Identical sequences A0A127ATP0 A0A127ATQ0 A0A127ATQ1 A0A127ATS9 A0A127ATT3 A0A127ATT5 A0A127ATV7 A0A127AU18 A0A127AU27 A0A127AV25 A0A127AV50 A0A127AX00 A0A127AX58 I7DJE7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]