SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I7GLI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I7GLI1
Domain Number 1 Region: 2-110
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.1e-42
Family Capz beta-1 subunit 0.00000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I7GLI1
Sequence length 114
Comment (tr|I7GLI1|I7GLI1_MACFA) Macaca fascicularis brain cDNA clone: QorA-13790, similar to human capping protein (actin filament) muscle Z-line, beta(CAPZB), mRNA, RefSeq: NM_004930.1 {ECO:0000313|EMBL:BAE88326.1} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN= OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYL
LCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLPITS
Download sequence
Identical sequences I7GLI1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]