SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I7KLM5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I7KLM5
Domain Number 1 Region: 2-61
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000000349
Family Phage repressors 0.024
Further Details:      
 
Weak hits

Sequence:  I7KLM5
Domain Number - Region: 44-206
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0018
Family Capz alpha-1 subunit 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I7KLM5
Sequence length 244
Comment (tr|I7KLM5|I7KLM5_9LACO) Uncharacterized protein {ECO:0000313|EMBL:CCI85469.1} KW=Complete proteome; Reference proteome OX=1423790 OS=Lactobacillus pasteurii DSM 23907 = CRBIP 24.76. GN=BN53_05120 OC=Lactobacillus.
Sequence
MNRIKEARKAKKISQKKLAELIGTTQQAISLYENDKREPNENSYSKLSKILDSSIDYLKG
NTYSKKELLTVFNNSYLDKNSMLRPKIIYYLDFINAIKPEQLFTAEQLEELTDSVKDYWL
KYFGFIFDANYKKAFGVEHPENFTIDFDTISRYKLTFEFMIKISKEIEKNSNASLINMRF
NTEVKPDIKQCLNVADLITTYGTKKQVLEFNNKLVDTINSFSKSLEGLPDNPNIDAEKVE
KYLD
Download sequence
Identical sequences I7KLM5
WP_009560021.1.32239 WP_009560021.1.54279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]