SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I7ZS79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I7ZS79
Domain Number 1 Region: 2-265
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.88e-88
Family Capz alpha-1 subunit 0.00000409
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I7ZS79
Sequence length 273
Comment (tr|I7ZS79|I7ZS79_ASPO3) F-actin capping protein, alpha subunit {ECO:0000313|EMBL:EIT74884.1} KW=Complete proteome OX=1160506 OS=Aspergillus oryzae (strain 3.042) (Yellow koji mold). GN=Ao3042_08878 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MASTVDIASSFIEGAPPGELADVVADVKTLTSSGADIIPSLAPAFERYNETQLATVKLPG
ASQEVLISEYNKLDGNRYFDVESQTSFEVDHVTQEASAAQSYVLDSQNADLIKSLLKSLG
AHAREHYPNCAYGVYPIENDSAVAILLVSNRYSPNNFWNGRFRATYQFPVSEPTTVTGKI
QVDVHYYEDGNVALNTNKPLNLSVSSLSAESIISRIATAERDYQEDLNRAFVQMAEGAFK
GLRRQLPITRQKVEWEKVGGYRLGQDISGGKGR
Download sequence
Identical sequences I7ZS79

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]