SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I8UA82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I8UA82
Domain Number - Region: 52-132
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0418
Family Capz alpha-1 subunit 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I8UA82
Sequence length 221
Comment (tr|I8UA82|I8UA82_9ALTE) ABC transporter auxiliary component {ECO:0000313|EMBL:EIW88873.1} KW=Complete proteome; Reference proteome OX=1195246 OS=Alishewanella agri BL06. GN=AGRI_08805 OC=Alteromonadaceae; Alishewanella.
Sequence
MKHLIRKCGAALLLAATMVLPAQATETYTDPYKLIETVADKTFSRIKADQPLIQQDLEHL
RVIVVEELLPYVDSRYAAGTVVGRAVDIRQNPEAFNAFVKAFEQYMIGSYAGALTYYKEQ
KVIIEPSQPVGNQQIFTIRTRVVDPGKPDIVIDFKLRRPRNAETWLVIDMIAEGISLLDS
KRAELSNLIRQQGLERVTALLQEKAKEPVKIPEQDPARASE
Download sequence
Identical sequences A0A259NPI7 I8UA82
WP_008984618.1.14482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]