SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I9Z576 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I9Z576
Domain Number - Region: 18-74
Classification Level Classification E-value
Superfamily TSP9-like 0.017
Family TSP9-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I9Z576
Sequence length 154
Comment (tr|I9Z576|I9Z576_HELPX) Uncharacterized protein {ECO:0000313|EMBL:EJC39097.1} KW=Complete proteome OX=992114 OS=Helicobacter pylori Hp P-28b. GN=HPHPP28B_0168 OC=Helicobacteraceae; Helicobacter.
Sequence
MELKNIISETLNEIEKMAKTIDNGFDVVQKTPSFFKTPPYLQNAKNAETPPMSNTEPKNA
TKIETQEKIAEEKEEAQGIITEEITPQNPTQAPISSERVFLKNLLERTLVLLKGMQALEE
KEALKRLDLVARFLQYQLSVLEKRLESLERENTK
Download sequence
Identical sequences I9Z576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]