SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J0UXG2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  J0UXG2
Domain Number - Region: 108-154
Classification Level Classification E-value
Superfamily IpaD-like 0.0366
Family IpaD-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J0UXG2
Sequence length 164
Comment (tr|J0UXG2|J0UXG2_9HELI) Flagellar basal-body rod protein FlgC {ECO:0000256|RuleBase:RU362062} KW=Complete proteome; Reference proteome OX=1177931 OS=Thiovulum sp. ES. GN=ThvES_00014290 OC=Helicobacteraceae; Thiovulum.
Sequence
MSGFLSNFDISGYGLSAQRARVNVISSNIANAQTTRTAEGGPYRRQELVFKAVDFDKEFN
KQLSENNELLKYEDPISEGLKGAVAKPPVMSVVVDKVVRDDSEPRMKYDPSHPDANSKGY
VAYPNINPVIEMSDLIEATRSYQANVSAFESAKKMANDAISLMS
Download sequence
Identical sequences J0UXG2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]