SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for J0XPX0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J0XPX0
Domain Number 1 Region: 605-702
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.16e-21
Family CHAP domain 0.014
Further Details:      
 
Weak hits

Sequence:  J0XPX0
Domain Number - Region: 496-568
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0418
Family Capz alpha-1 subunit 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J0XPX0
Sequence length 723
Comment (tr|J0XPX0|J0XPX0_9ENTE) N-acetylmuramoyl-L-alanine amidase {ECO:0000313|EMBL:EJF50736.1} KW=Complete proteome OX=1182762 OS=Enterococcus sp. C1. GN=YS9_0620 OC=Enterococcus.
Sequence
MKNKKIGITLISLGVLAAQSFTTPTLLASNLTDHLSDKSEDASQSTFSKERKQSNVDLQE
PNIELVSSMRQASNVTSNIAMSTSSKTELSSGYVPIIEESSESSDESTDFPEESHWEDEE
LGEENTEEQESDKPEESQQPDIPIEETIPSEVPEAEQTVPPSSEAPVQPDAPTSSTNQED
QSSDSGANPFPPSAPVTRPPATDQEIDTIFEGLLNSAENQLPDAFRSSEVAESTLGSFTL
PLLASFDHSWQAALVYQTIRQVGADDLESKEVDTWLKELYNEVLATNLENLDMKESTYNS
LQPGDILYKETAEGNQLLGIWLGNDYYGTIGTQEMSETLEQESQEDEVNEDVDLNQSATS
VVYLEKLSYQQVDQEEWDEENISLLIKRAQSPELTEVGKELVKNYPAQLDFQFNTATHEF
IKQISEKARKLGQEYDVFASVLIAQAILESGNGSSLLSKAPYYNLFGIKGSYREGAVVMT
TKEDLGNGEMIEIQDAFRVYPSYDESLTDYIALIRGGVSHDSSFYKSVWRSEAKNYLRAT
DALTGTYATDTSYNQKLNSLIAVYELTQYDEDQSQQSGVFIKGLEEVPNEYRELMTFPAY
NGKDYNTSGSYPVGQCTWYAFNRVAQLGGRVDDYMGNGGDWGTTGLRLGYQVSRTPKAGT
LISFSHGTAGSDPRYGHVAFVEAVGPNGILISEANVYGGTTISYRVIGNDLARSSLVQYI
TPK
Download sequence
Identical sequences J0XPX0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]