SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for J0YNW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  J0YNW6
Domain Number - Region: 58-179
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0366
Family Capz alpha-1 subunit 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J0YNW6
Sequence length 442
Comment (tr|J0YNW6|J0YNW6_9STRE) 3-isopropylmalate dehydrogenase {ECO:0000313|EMBL:EJG85899.1} KW=Complete proteome; Reference proteome OX=1159208 OS=Streptococcus infantis SPAR10. GN=SPAR10_1498 OC=Streptococcus.
Sequence
MRITDNQHKIIKEDFVAEYPKISQLLLDRTLGNLSQEDNIFIFPSDLEYSPDLDKDQKIL
ETVNREIKTGNIIGFLGYGQERLTISSRFSNESNDYFLHYLLQKVLHINLTSLDVALSRE
DKLYQLLMYLFPKYLQVALRKGLYKEYQRFSHNDSHVKGVIDVGNHLKKNLPFTGNIAYT
TREFTYDNPLMQLIRHTIEFMKNQKSIGRGVLENLSTSRENVSEIIRVTPSYKLADRAKI
IRLNQTKPLRHAYFREYRKLQELCLMILNREKHGLGYQEQKIHGILFDVAWLWEEYVHTL
LPKEFIHPRNKDKMDGISVFSNRERKIFPDFYHKELKIVLDAKYKKLELTEKGINREDLF
QLISYSYILKAEQAGLVFPSKEKVVDNEIGKLAGHGALLKKWSIQVPGQAEGYQDFVRKM
ESFEKVFIENLGRNLKGKRNSG
Download sequence
Identical sequences J0YNW6
WP_004253484.1.69269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]