SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for J3JUE7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J3JUE7
Domain Number 1 Region: 2-254
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 8.11e-94
Family Capz beta-1 subunit 0.00000000334
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J3JUE7
Sequence length 276
Comment (tr|J3JUE7|J3JUE7_DENPD) Uncharacterized protein {ECO:0000313|EMBL:AEE61822.1, ECO:0000313|EnsemblMetazoa:ENN71119} KW=Complete proteome; Reference proteome OX=77166 OS=Dendroctonus ponderosae (Mountain pine beetle). GN=D910_07340 OC=Cucujiformia; Curculionidae; Scolytinae; Dendroctonus.
Sequence
MGDQFDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIAKDQETGQDYVL
CDYNRDGDSYRSPWSNTYYPPLDDGQMPSERLRKLEHDANLAFDQYREMYFEGGVSSVYF
WDLDHGFAGVILIKKIGNGSKKINGCWDSLHVVEVQEKSSGRTSHYKMTSTTMLWLQTNE
TGSGTMNLGGSLTRQIEQDAVVNENNSHIVNIGKMVEEMENKIRNTLNEIYFSKTKDIVN
SLRSVEPLTDSKQNEIMKHRIELASVLQKRHNKSDN
Download sequence
Identical sequences J3JUE7
XP_019770525.1.59312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]