SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for J3KJ44 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J3KJ44
Domain Number 1 Region: 4-265
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 5.1e-82
Family Capz alpha-1 subunit 0.00000573
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J3KJ44
Sequence length 273
Comment (tr|J3KJ44|J3KJ44_COCIM) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:EAS36043.3} KW=Complete proteome; Reference proteome OX=246410 OS=Coccidioides immitis (strain RS) (Valley fever fungus). GN=CIMG_01397 OC=Eurotiomycetidae; Onygenales; Onygenales incertae sedis; Coccidioides.
Sequence
MPSNIEIASSFVEGAPPGELNDVVADIKALTSDGPDIINSLEPAFRSYNETQLTTTKLAG
SSQEVIVSSYNRLEDGRYYDVESQTAFEFDHVSQIASAPKSHPLESQNSDLIKSLLKSLS
SHTREHFVSCSYGVYPTDNDSSVTILLVANKYSPNNFWNGRYRTIYHVPISSPTTITGKI
HVDVHYYEDGNVSLNNTKPVSIPIQSTSAETIVRRIAAAEREHQQELNEAFGRLAEGAFK
GLRRQLPITRQKVEWEKVGGYRLGQDIAGGRGQ
Download sequence
Identical sequences A0A0J6Y3Y7 A0A0J8RAM9 A0A0J8U9T1 C5PGK7 E9CWE9 J3KJ44
CIHT_01645 CIMG_01397T0 222929.C5PGK7 XP_001247626.1.59393 XP_003065805.1.1890 CPSG_01782T0 CIST_09201 CIRT_01490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]