SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J3M1W9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J3M1W9
Domain Number 1 Region: 7-136
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.45e-41
Family Calponin-homology domain, CH-domain 0.0000399
Further Details:      
 
Domain Number 2 Region: 187-245
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 7.45e-20
Family EB1 dimerisation domain-like 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J3M1W9
Sequence length 269
Comment (tr|J3M1W9|J3M1W9_ORYBR) Uncharacterized protein {ECO:0000313|EnsemblPlants:OB04G33940.1} KW=Complete proteome; Reference proteome OX=4533 OS=Oryza brachyantha (malo sina). GN=102706842 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MAAAAAATIGMMDGAYFVGRGEILSWINATLQLSLGKVEEAASGAVQCQLMDMVHPGVVP
MHKVNFDAKTEYDMIQNYKILQDVFNKLRLSKNIEVTKLVKGRPLDNLEFMQWLKRYCDS
VNGGIMNENYNPVERRSKGCKERSLKGSNKSSKSLQANRLSSANSADGGLCIGKVCNAIA
EEHYREQIQQLSEKIADLKISVDSAEKERDFYFSKLRDIEILCQRPELEHLPMSKAIKKI
LYAADARDSPLPEANEIITRSPGMFSDEA
Download sequence
Identical sequences J3M1W9
XP_006653813.1.55871 XP_015691849.1.55871 OB04G33940.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]