SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J3NS76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J3NS76
Domain Number 1 Region: 9-161
Classification Level Classification E-value
Superfamily Eukaryotic RPB5 N-terminal domain 5.1e-35
Family Eukaryotic RPB5 N-terminal domain 0.0000773
Further Details:      
 
Domain Number 2 Region: 158-232
Classification Level Classification E-value
Superfamily RPB5-like RNA polymerase subunit 3.01e-28
Family RPB5 0.0000496
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J3NS76
Sequence length 233
Comment (tr|J3NS76|J3NS76_GAGT3) DNA-directed RNA polymerase I {ECO:0000313|EMBL:EJT79032.1} KW=Complete proteome; Reference proteome OX=644352 OS=barley take-all root rot fungus). GN=GGTG_04121 OC=Gaeumannomyces.
Sequence
MESTEAKTREARRLWRAWRTAHEMLQDRGYELSQEEVNISLDRFLQQYTDGAGNVDASKL
KFSAHPSEAMIKKHTPPPTEQRPDPVPECGTVWVEFMGDASDKSLGIQAIRSFIQYTVEH
NFHTGIMITKSPISSGSRKLIGASANYATIEAFMLDDMLVNITHHELVPKHVLLSKIEKA
ALLERYRLKETQLPRIQVKDPVARYLGLKRGNVVKIIRSSETAGRYASYRLTV
Download sequence
Identical sequences J3NS76
XP_009220177.1.29638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]