SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J3UQC6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  J3UQC6
Domain Number - Region: 74-94
Classification Level Classification E-value
Superfamily YonK-like 0.051
Family Yonk-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J3UQC6
Sequence length 133
Comment (tr|J3UQC6|J3UQC6_BACTU) Uncharacterized protein {ECO:0000313|EMBL:AFQ17161.1} KW=Complete proteome OX=1218175 OS=Bacillus thuringiensis HD-771. GN=BTG_18655 OC=Bacillus cereus group.
Sequence
MCLFGKYWHKLSRLFNRQLGYFLDDKLLPAVERLLFSQNFARFIQRNSKQATEEFIKSSQ
FQSIICNILKECNTSPFKEIAKQYLGKNVEITVTVGQLTGVIVAVGDDFLTLQEGIGTEV
LLPFTSIISIKEV
Download sequence
Identical sequences A0A0Q0RFR9 A0A0Q9GWI3 A0A0Q9H0J3 A0A160L7H4 A0A242Y7W6 A0A243B2G9 A0A243MNC0 A0A2B9ER30 A0A2H3QUZ8 B7IVZ5 J3UQC6 J7VQ16 J8EWW0 Q3EVU6 R8C0Z8 R8IC54 R8SQX3 R8XQJ0
gi|402562470|ref|YP_006605194.1| gi|434373552|ref|YP_006608196.1| 405531.BCG9842_B4817 gi|218895559|ref|YP_002443970.1| WP_000335512.1.100497 WP_000335512.1.101838 WP_000335512.1.12935 WP_000335512.1.13269 WP_000335512.1.22084 WP_000335512.1.26459 WP_000335512.1.27446 WP_000335512.1.28599 WP_000335512.1.34537 WP_000335512.1.3546 WP_000335512.1.35769 WP_000335512.1.36279 WP_000335512.1.38325 WP_000335512.1.4355 WP_000335512.1.48759 WP_000335512.1.50042 WP_000335512.1.52284 WP_000335512.1.58712 WP_000335512.1.59384 WP_000335512.1.60526 WP_000335512.1.61799 WP_000335512.1.6241 WP_000335512.1.64421 WP_000335512.1.70667 WP_000335512.1.73638 WP_000335512.1.83666 WP_000335512.1.87649 WP_000335512.1.87705 WP_000335512.1.89145 WP_000335512.1.92555 WP_000335512.1.9703 WP_000335512.1.97821 WP_000335512.1.97830 WP_000335512.1.98315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]