SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for J4G068 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J4G068
Domain Number 1 Region: 3-273
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.27e-68
Family Capz alpha-1 subunit 0.00000496
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) J4G068
Sequence length 286
Comment (tr|J4G068|J4G068_9APHY) Uncharacterized protein {ECO:0000313|EMBL:CCL98413.1} KW=Complete proteome; Reference proteome OX=599839 OS=Fibroporia radiculosa. GN=FIBRA_00410 OC=Agaricomycetes; Polyporales; Polyporales incertae sedis; Fibroporia.
Sequence
MESQQRIEAVSRFLLQSPPGEINDVLNDVRNIISDDDSLQEGVLPALREYNLAQFITADV
PGHNHQSIISDSAKVTNLSGAGDTDEVLDRFWDPRSRTSFRFDHISLEASEPEPIEPDAA
SEPFRAALEASSLSYLTAHFHDGVASVFPAQGFASRFYIQIVANKYNPSNFWSGRWRSEY
IIDLEEKQLKGKILVNVHYYEQGNVQLSTTHTVELPLPPTIVPSSAASSASKVLAVIEVE
EEMGEKTFKGLRRALPMTRSKLDWDKVLGYKLGAELTSSRGVMSAS
Download sequence
Identical sequences J4G068
XP_012177696.1.98339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]