SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for J4QFJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  J4QFJ7
Domain Number - Region: 66-147
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00154
Family Capz alpha-1 subunit 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J4QFJ7
Sequence length 443
Comment (tr|J4QFJ7|J4QFJ7_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:EJO50544.1} KW=Complete proteome OX=936588 OS=Veillonella sp. ACP1. GN=HMPREF1151_0415 OC=Veillonella.
Sequence
MLKLPLIVGAFIMSTILSPVKAIDVNIPGADPKIPKDAYINYQATNQTIEQDVANYVETL
KSTDKANGISRNELAYAKEASIYRGEHYHNTVISVYNHYSQIRLSFPVASIKSEYNIGRY
KNPDRTIEDYRVITDNGNLNLEIDYADYKDQDWRNTKIAYEKLTDKDVRKFLQDKAKKNL
EKHISDIKATVFSYPTVTYSTWDSMKMPYLKNGQKTTMTVDTINFKHMGFAIRYPLYHAG
IAYFDNKPVLNKVPTDNLLANYVLPSMKNLNELNEYSRIENLNGIQYRVPKDAIFDGESK
DEYQDIRYYKKGTITFFISTINPAKNPYAGNPIINGHYNFNRELRSFWDMYRYHPTPDYI
NYSVVWNNNIPGLSIHSYEPYRDNHILNFESYDGTYHFIYIIFYPKFLSADEVQKLRNMI
EFFDSTNNPEFKLQQHVVFPENR
Download sequence
Identical sequences J4QFJ7
WP_009660589.1.27349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]