SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J4USG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J4USG0
Domain Number 1 Region: 1-40
Classification Level Classification E-value
Superfamily Zinc domain conserved in yeast copper-regulated transcription factors 0.00000000000000196
Family Zinc domain conserved in yeast copper-regulated transcription factors 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J4USG0
Sequence length 290
Comment (tr|J4USG0|J4USG0_BEAB2) Copper fist DNA binding domain protein {ECO:0000313|EMBL:EJP68602.1} KW=Complete proteome; Reference proteome OX=655819 OS=fungus) (Tritirachium shiotae). GN=BBA_02604 OC=Beauveria.
Sequence
MIIDGETYACEGCIRGHRTRNCQHSDRPLQHIKAKGRPVSQCNHCRSERKNRSAHVKCQC
GKRASEGGSDCGCFSGGKCKCATKKSPKQAPTQLGDISETLSDLASPASTLNTASPAQLS
TSGDLQWSNAATPASDFTSLDGLAQFDPNSWLNTPQLDAAAAFGGSAVDHSSALATLPTT
GAETGFQSANYQQQFPMGVPDFANVNDWPALDDESAKQFLAMMDHPAGMDLTGLDASALN
TTGGFNMDPTFGLDFSSLNQQQPSAQPVTETTNGANCNSKREGGCGPCCG
Download sequence
Identical sequences J4USG0
XP_008595923.1.71110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]