SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for J5PHS0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J5PHS0
Domain Number 1 Region: 1-262
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.7e-79
Family Capz alpha-1 subunit 0.0000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) J5PHS0
Sequence length 268
Comment (tr|J5PHS0|J5PHS0_SACK1) CAP1-like protein {ECO:0000313|EMBL:EJT42523.1} KW=Complete proteome; Reference proteome OX=226230 OS=8840 / NBRC 1802 / NCYC 2889) (Yeast). GN=SKUD_178802 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MSSSKFKEVVNKIISDCPPGELREVYDDLIKITSENSKNTLLDAIESYNVQNCIPVDVDG
TFIIISKYNKEGSKFFDPINSVIFSVDHLGHKGLDIEPYEFIHSKLEKQQLKDLHDKLHE
YLLQNFPGDVSLAVYPVPEEISKISIIIVSTKYNPNNFWNGHWRSSYIYDLDTKELTGHI
STQVHYYEDGNVSFQSGKDVSQPNVVDVVSTIRDIETSFESDLDLSFSDLNEKQFKALRR
RLPVTRSKINWGNAIGGYRLGKNAAEGK
Download sequence
Identical sequences J5PHS0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]