SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for J5TFK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J5TFK9
Domain Number 1 Region: 5-116,331-468
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 8.37e-55
Family Capz alpha-1 subunit 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) J5TFK9
Sequence length 475
Comment (tr|J5TFK9|J5TFK9_TRIAS) F-actin capping {ECO:0000313|EMBL:EJT50686.1} KW=Complete proteome OX=1186058 OS=2466 / KCTC 7840 / NCYC 2677 / UAMH 7654) (Yeast). GN=A1Q1_08238 OC=Tremellomycetes; Trichosporonales; Trichosporonaceae; Trichosporon.
Sequence
MAELSPEERIKLAVQFIAQSPPGEVNAVEHEADEAANIYPHVSLLSEAVIAPTTGTQERF
VDFEAARSFSFDHVRMTPSDYEPYVLPSKDEAIRKSFAESLSAYTRNHFTEGRWSVACDQ
YPVATAAVGVLEPAPTPTGSQSGSVSASVPPSRAVSPAVPPIPEGIAVPSDTPADGTSSA
ASDLPKDAEVDAPGGLKDLDDEMEGVAERLDPTGTAALGETPGKLEPEPTPSVGDADLPK
DAEVDQPGALADLDREIAEEVEAEAEAMAEDNAASGAAAGAPAATGAAAVDDEKFTSLDA
KLAEVEAADAAGGHEIPSASATPAALKQTPIAQESRAHPSYTLEVVGNRYNPSNFWTGRW
RTRWVVDPAVGTVTGTILVDVHYYEQGNVQLSTEHRAAFPVPVETWEDGRDAASQIVGTI
AKIEQAYQLELGDVYEEFGEKSFRNLRRALPVTRQKIDWDKVQGYSLGSDLSKAR
Download sequence
Identical sequences J5TFK9
XP_014181860.1.42847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]