SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J7I1R5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J7I1R5
Domain Number 1 Region: 8-74
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000525
Family DNA-binding N-terminal domain of transcription activators 0.07
Further Details:      
 
Weak hits

Sequence:  J7I1R5
Domain Number - Region: 184-232
Classification Level Classification E-value
Superfamily PG0775 C-terminal domain-like 0.0301
Family PG0775 C-terminal domain-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J7I1R5
Sequence length 238
Comment (tr|J7I1R5|J7I1R5_BACTU) Uncharacterized protein {ECO:0000313|EMBL:AFQ20064.1} KW=Complete proteome OX=1218175 OS=Bacillus thuringiensis HD-771. GN=BTG_33675 OC=Bacillus cereus group.
Sequence
MDFGRFSGQVSKELDVNGNTLRVWCLELESAGYKFERNNRQQRIYYEHDITILKEMKVLM
ADGTRTLQEAISLLLESSLSKDTDNALTHSINDSDGSEITPLQRNNSAVGVAYAILEQTN
EKVAELIKQQQIIALQNQEILNVIHKDNEEKQLVIQAVFEKQQQLIEQQQDIHLQNQNLT
KMYLDEREEKLKERQEKNELKEQLSDMQEKMNEMLKFVHQQSEERSKSFLSKFFSKKT
Download sequence
Identical sequences J7I1R5 J7VRM1 R8XBJ1
WP_000345488.1.27446 WP_000345488.1.34537 WP_000345488.1.59384 gi|402558818|ref|YP_006594102.1| gi|402558818|ref|YP_006594102.1|NC_018489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]