SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J8A2J3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J8A2J3
Domain Number 1 Region: 1-110
Classification Level Classification E-value
Superfamily Hypothetical protein YhaI 2.88e-48
Family Hypothetical protein YhaI 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) J8A2J3
Sequence length 111
Comment (tr|J8A2J3|J8A2J3_BACCE) Uncharacterized protein {ECO:0000313|EMBL:EJQ75803.1} KW=Complete proteome OX=1053206 OS=Bacillus cereus HuA4-10. GN=IGC_04454 OC=Bacillus cereus group.
Sequence
MDVVRRLEQAEYYVDLLFKMIDEEKCPFYSLIIKKKARKKDIERILKLCEKLNEQYVVEK
AEGLLLFDALLDQFEKALPHQLEVHETAEALAKQGLFKPLMNEFLRMIAKK
Download sequence
Identical sequences A0A1C4B340 A0A2C2VSI1 J8A2J3 J8AGV9 J8FNT9 J8WU62 R8KTH2
WP_002150076.1.100215 WP_002150076.1.10775 WP_002150076.1.23136 WP_002150076.1.27138 WP_002150076.1.38270 WP_002150076.1.50487 WP_002150076.1.53672 WP_002150076.1.53916 WP_002150076.1.66471 WP_002150076.1.67742 WP_002150076.1.72824 WP_002150076.1.73166 WP_002150076.1.75300 WP_002150076.1.84520 WP_002150076.1.84599 WP_002150076.1.89263 WP_002150076.1.89564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]