SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for J9DGA9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9DGA9
Domain Number 1 Region: 326-395
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000528
Family PCI domain (PINT motif) 0.051
Further Details:      
 
Weak hits

Sequence:  J9DGA9
Domain Number - Region: 96-209
Classification Level Classification E-value
Superfamily TPR-like 0.0303
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 
Domain Number - Region: 15-46
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0628
Family Capz alpha-1 subunit 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J9DGA9
Sequence length 425
Comment (tr|J9DGA9|J9DGA9_EDHAE) Uncharacterized protein {ECO:0000313|EMBL:EJW01630.1} KW=Complete proteome; Reference proteome OX=1003232 OS=Edhazardia aedis (strain USNM 41457) (Microsporidian parasite). GN=EDEG_03826 OC=Eukaryota; Fungi; Microsporidia; Edhazardia.
Sequence
MDTLSILKSAKTQPEEKEEILHSFISRQPLSEISKILKDLPNLWPNVSIARTTKIIKKIL
KEIPQTEDTLHLINNLIDLYSTKKLLKLELECRKVSLLLNLKQYSQCFISISSLLKELKK
HDDKVNQISLYVYESIANYEIRNYSKAKSALTSARALSVSTFCPSSLQAKIDKLSGMYLC
LDKNYRTAYSYFLESIDSFLMEKMFFDAVIVARYLVLCGIVDGKKDLECVIRKVGEKIGT
FKVTNEELTSYSKFISQNGNQKDNTSRTNFSCENLKNTSTMKHSILTDLLNDKIINILLK
IEKCSKDRDLLQYNTILTQNKDLLQDDPFLITHLHVLYEKLLENNIIKILESYSSLKIDY
VANKIGLTVDVVENKIRNMILDGSVNGIIDHVNRNYVLRKQVRRSEGDKELMDMIDLFIA
FTEKM
Download sequence
Identical sequences J9DGA9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]