SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9DJU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  J9DJU7
Domain Number - Region: 32-100
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.0445
Family Occludin/ELL domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) J9DJU7
Sequence length 130
Comment (tr|J9DJU7|J9DJU7_EDHAE) Uncharacterized protein {ECO:0000313|EMBL:EJW02895.1} KW=Complete proteome; Reference proteome OX=1003232 OS=Edhazardia aedis (strain USNM 41457) (Microsporidian parasite). GN=EDEG_02719 OC=Eukaryota; Fungi; Microsporidia; Edhazardia.
Sequence
MAHFYIYANQLINLISYTNSSPNRFVRAQREQKISYIQEQIFYVEKELDRIKLEANSFEN
IKNQNIQYNEAHMNHNFTGKYDGSTVLRKIEELKNIKLQIAREHDLLRSKKDLLESNLRV
EKNNLQRLTD
Download sequence
Identical sequences J9DJU7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]