SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for J9EK01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9EK01
Domain Number 1 Region: 1-252
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.83e-86
Family Capz beta-1 subunit 0.0000000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) J9EK01
Sequence length 257
Comment (tr|J9EK01|J9EK01_WUCBA) F-actin-capping protein subunit beta {ECO:0000313|EMBL:EJW82786.1} KW=Complete proteome; Reference proteome OX=6293 OS=Wuchereria bancrofti. GN=WUBG_06303 OC=Spiruromorpha; Filarioidea; Onchocercidae; Wuchereria.
Sequence
MRRLPPQQVERNLNDLIDLCPRLVDDLLSAVDQPLKIARDKETGKEYLLCDYNRDSDSYR
SPWSNTYDPPLEDGASPSDKLRKLEIEMNAAFEAYRDAYFEGGVSSVYFWDLDYGFAGVV
LIKKIGDGLRNIQGCWDSIHVIEIQEKAGGRHAHYKLTSTVMLWLQMTKQASGMMNLGGS
VTRQVEADHPVNDSTNTHLINIGKMIEDMESKIRSTLNEVYFGKTKQIVGELRTTLDAEE
LKRQKKIATEIKGGIGK
Download sequence
Identical sequences J9EK01
WUBG_06303T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]