SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for J9FFL8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9FFL8
Domain Number 1 Region: 8-282
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.84e-88
Family Capz alpha-1 subunit 0.000000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J9FFL8
Sequence length 287
Comment (tr|J9FFL8|J9FFL8_WUCBA) F-actin-capping protein subunit alpha-1 {ECO:0000313|EMBL:EJW86124.1, ECO:0000313|WBParaSite:maker-PairedContig_212-snap-gene-0.13-mRNA-1} KW=Complete proteome; Reference proteome OX=6293 OS=Wuchereria bancrofti. GN=WUBG_02964 OC=Spiruromorpha; Filarioidea; Onchocercidae; Wuchereria.
Sequence
MTEGNVISGSDSIRIVSNFLLHSPPGEFNEVFNDVRMLLNNDNLLKDGCAVIFAQYNKEQ
FIPVKLESVDRQTLITPFNEMSNGRFYDPRSRNSFKYEHLRKEATDIQIENANDGSSETW
RKAVQEEADKYIDSHYEETGIAAVFVNNGSLTLCIESHRYQPKNFWNGRWRSQWTIPIAD
GKNEQCEIKGIIKVHVHYYEDGNVQLVSTKETSAKITYTADFAQTAKDVFRIIWDEESKY
QDAVQENYQQMSATTFKALRRQLPVTGVKFDWNNTHAYRISKDLKPQ
Download sequence
Identical sequences J9FFL8
WUBG_02964T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]