SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for J9HTE5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9HTE5
Domain Number 1 Region: 17-94
Classification Level Classification E-value
Superfamily UBC-like 7.24e-17
Family UBC-related 0.003
Further Details:      
 
Weak hits

Sequence:  J9HTE5
Domain Number - Region: 210-285
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0968
Family Capz alpha-1 subunit 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J9HTE5
Sequence length 287
Comment (tr|J9HTE5|J9HTE5_9SPIT) Ubiquitin-conjugating enzyme domain-containing protein {ECO:0000313|EMBL:EJY67699.1} KW=Complete proteome; Reference proteome OX=1172189 OS=Oxytricha trifallax. GN=OXYTRI_11791 OC=Stichotrichia; Sporadotrichida; Oxytrichidae; Oxytrichinae; Oxytricha.
Sequence
MKREEFIVKLYEDLINQGLPSGMYVTIQAPSIDQQIQSWDALLFIHSGLYEGAIFKFNIH
FPDRFPLKFPKVQFMNKIYHPLIDFECGYLDYSSIINFKINPEEKIFLKSLTIDSNNKEN
FNSQNIQPDTSNIKLPSLPDGFMIELLQFIWNIFYDQTLLQKLSPKNCFNPQAQLAYKFN
QPDFLKYCTLTVQSSLQLLETLTFSDNNSQQNPQSNQIESMLQVQVNYQNQEELQQVIQM
QAQIKQKIQKHQEEGLDQEQIIDKISNEFINEINKEAQQYSNSTYYQ
Download sequence
Identical sequences J9HTE5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]